DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and RAD23A

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_005044.1 Gene:RAD23A / 5886 HGNCID:9812 Length:363 Species:Homo sapiens


Alignment Length:78 Identity:27/78 - (34%)
Similarity:46/78 - (58%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNI-QK 63
            |.:|||..:|..:.:||.:|::.:|.||:.::|   .|...|:||:|||.|.|...:.||.| :|
Human     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69

  Fly    64 ESTLHLVLRLRGG 76
            ...:.:|.:.:.|
Human    70 NFVVVMVTKTKAG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 26/76 (34%)
Ribosomal_S27 103..147 CDD:460261
RAD23ANP_005044.1 rad23 3..361 CDD:273167 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..160 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..227
HIV-1 vpr binding 319..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.