DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and UBQLN4

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_064516.2 Gene:UBQLN4 / 56893 HGNCID:1237 Length:601 Species:Homo sapiens


Alignment Length:90 Identity:29/90 - (32%)
Similarity:47/90 - (52%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSD--TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
            :::.|||...|.   |:...|  :::..|.:|..:.....||..||||||.|:||.||:.:.|:.
Human    13 IRVTVKTPKDKE---EIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKD 74

  Fly    64 ESTLHLVLRLRGGAKKRKKKNYSTP 88
            ..|:|||::....|:.......|:|
Human    75 GLTVHLVIKTPQKAQDPAAATASSP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 26/76 (34%)
Ribosomal_S27 103..147 CDD:396259
UBQLN4NP_064516.2 UBQ 13..83 CDD:214563 26/72 (36%)
hPLIC_N 13..83 CDD:176403 26/72 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..155 3/13 (23%)
STI1 192..229 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..366
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..533
UBA_PLICs 558..597 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.