DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and UBQLN4

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_064516.2 Gene:UBQLN4 / 56893 HGNCID:1237 Length:601 Species:Homo sapiens


Alignment Length:90 Identity:29/90 - (32%)
Similarity:47/90 - (52%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSD--TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
            :::.|||...|.   |:...|  :::..|.:|..:.....||..||||||.|:||.||:.:.|:.
Human    13 IRVTVKTPKDKE---EIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKD 74

  Fly    64 ESTLHLVLRLRGGAKKRKKKNYSTP 88
            ..|:|||::....|:.......|:|
Human    75 GLTVHLVIKTPQKAQDPAAATASSP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 26/76 (34%)
Ribosomal_S27 103..147 CDD:460261
UBQLN4NP_064516.2 Ubl_PLICs 11..83 CDD:340506 26/72 (36%)
rad23 13..>291 CDD:273167 29/90 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..155 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..366
STI1 393..>424 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..533
UBA_PLICs 558..597 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.