DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and faub

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001017866.2 Gene:faub / 550564 ZFINID:ZDB-GENE-050417-416 Length:133 Species:Danio rerio


Alignment Length:122 Identity:32/122 - (26%)
Similarity:63/122 - (51%) Gaps:25/122 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTI-TLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
            ||:||:   |::: ::::..|:|:.::||:|:..||:..|.|.:..:|..|||...:....|::.
Zfish     1 MQLFVR---GQSLHSVQLNGSETVAHIKAQIEALEGLACDDQIISLSGIPLEDDALICQSGIEEF 62

  Fly    65 STLHLVLRLRGG---------------------AKKRKKKNYSTPKKIKHKRKKVKL 100
            :||.:..||.||                     .:||||:.....::|::.|:.|.:
Zfish    63 NTLEVSSRLLGGKVHGSLARAGKVRGQTPKVDKQEKRKKRTGRAKRRIQYNRRFVNV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 23/75 (31%)
Ribosomal_S27 103..147 CDD:460261
faubNP_001017866.2 Ubl_FUBI 1..74 CDD:340491 23/75 (31%)
Ribosomal_S30 75..132 CDD:398432 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.