DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and ubl7a

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001017765.1 Gene:ubl7a / 550462 ZFINID:ZDB-GENE-050417-285 Length:379 Species:Danio rerio


Alignment Length:104 Identity:32/104 - (30%)
Similarity:49/104 - (47%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EVEPSD---------TIEN-VKAKIQDKEGIP-PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 69
            |.||.|         |::. |.|:|.|  .|| |:...|::.|::|:|..||..|.||..||:|:
Zfish    27 EAEPGDVPPGEYRVSTLKQLVSAQIPD--AIPDPELIELVYCGRKLKDDLTLESYGIQSGSTVHI 89

  Fly    70 VLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKV 108
            :         ||    |.|:...|.....|:|..:.::|
Zfish    90 L---------RK
----SWPEPEIHPEPVDKVAAAREFRV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 24/70 (34%)
Ribosomal_S27 103..147 CDD:396259 1/6 (17%)
ubl7aNP_001017765.1 UBQ 19..92 CDD:294102 24/75 (32%)
UBQ <40..88 CDD:214563 19/49 (39%)
UBA_UBL7 337..374 CDD:270511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.