DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and rad23aa

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001003739.1 Gene:rad23aa / 445284 ZFINID:ZDB-GENE-040808-59 Length:362 Species:Danio rerio


Alignment Length:68 Identity:24/68 - (35%)
Similarity:44/68 - (64%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            |||.:|||..:||.::::...|::.:|.||:.::|   .|...|:||:|||.|:|...:.:|.|.
Zfish     1 MQITLKTLQQQTIQIDIDDEQTVKALKEKIEAEKGRDSFPVAGQKLIYAGKILQDDTPIKEYKID 65

  Fly    63 KES 65
            :::
Zfish    66 EKN 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 24/68 (35%)
Ribosomal_S27 103..147 CDD:396259
rad23aaNP_001003739.1 rad23 1..360 CDD:273167 24/68 (35%)
RAD23_N 1..78 CDD:176400 24/68 (35%)
UBA1_HR23A 160..199 CDD:270608
XPC-binding 228..283 CDD:286376
UBA2_HR23A 318..358 CDD:270610
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.