powered by:
Protein Alignment RpS27A and rad23aa
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001003739.1 |
Gene: | rad23aa / 445284 |
ZFINID: | ZDB-GENE-040808-59 |
Length: | 362 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 24/68 - (35%) |
Similarity: | 44/68 - (64%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
|||.:|||..:||.::::...|::.:|.||:.::| .|...|:||:|||.|:|...:.:|.|.
Zfish 1 MQITLKTLQQQTIQIDIDDEQTVKALKEKIEAEKGRDSFPVAGQKLIYAGKILQDDTPIKEYKID 65
Fly 63 KES 65
:::
Zfish 66 EKN 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.