DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and CG10694

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster


Alignment Length:92 Identity:26/92 - (28%)
Similarity:54/92 - (58%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65

  Fly    64 ESTLHLVLRLRGGAKKRKKKNYSTPKK 90
            :.    ::.|.|    :||.:.|:|::
  Fly    66 DK----IIVLMG----KKKVDKSSPEE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 21/76 (28%)
Ribosomal_S27 103..147 CDD:396259
CG10694NP_651212.1 rad23 1..284 CDD:273167 26/92 (28%)
UBQ 1..76 CDD:294102 22/82 (27%)
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.