DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and CG31528

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster


Alignment Length:83 Identity:20/83 - (24%)
Similarity:36/83 - (43%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL 73
            :|:..|:.:..::.|.|::..:..:......:..|:|||:.|.|..|:....|....|:|:|.|.
  Fly    14 SGRVETVTLRQNELIRNLRVLVAVRFEQAISRIILVFAGQVLSDEGTIDSRGIVSGVTVHVVCRA 78

  Fly    74 RG---------GAKKRKK 82
            ..         .|.||.|
  Fly    79 EAANSPSPTPIAATKRSK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 16/75 (21%)
Ribosomal_S27 103..147 CDD:460261
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 15/62 (24%)
UBA_like_SF 299..335 CDD:473871
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.