powered by:
Protein Alignment RpS27A and Oas1d
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038945418.1 |
Gene: | Oas1d / 304508 |
RGDID: | 1310349 |
Length: | 389 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 10/50 - (20%) |
Similarity: | 22/50 - (44%) |
Gaps: | 4/50 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 TITLEVEPSDTIENVKAKIQDKEGI---PPDQQRLIFAGKQLEDGRTLSD 58
|:..:...::..|.:..::|....: |.|..|.: ||..|:....|::
Rat 280 TLCYDFNHNEVSEYLNKQLQKDRPVILDPADPTRNV-AGSNLQAWHLLAE 328
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.