DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and F52C6.4

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001379809.1 Gene:F52C6.4 / 186086 WormBaseID:WBGene00018661 Length:100 Species:Caenorhabditis elegans


Alignment Length:36 Identity:17/36 - (47%)
Similarity:25/36 - (69%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI 36
            |.:.|||.||||||:|..     :|||.:::||:|:
 Worm     1 MLLSVKTSTGKTITVEAP-----KNVKTEVRDKQGV 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 17/36 (47%)
Ribosomal_S27 103..147 CDD:460261
F52C6.4NP_001379809.1 Ubl1_cv_Nsp3_N-like 1..>31 CDD:475130 16/34 (47%)
Ubl1_cv_Nsp3_N-like 72..>100 CDD:475130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.