DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and F52C6.3

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_494127.2 Gene:F52C6.3 / 186085 WormBaseID:WBGene00018660 Length:197 Species:Caenorhabditis elegans


Alignment Length:72 Identity:28/72 - (38%)
Similarity:43/72 - (59%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE---DGRTLSDYNIQ 62
            ::|:|:. .|:|.||:...|||:.:|||||.:|..|.|:.|:|:.....|:   |..||.|.:.:
 Worm   103 IRIYVEN-AGRTCTLDTSASDTMASVKAKIWEKLRILPNTQKLLLENWDLDLFSDHSTLFDNSFE 166

  Fly    63 KESTLHL 69
            ..|||.|
 Worm   167 NGSTLRL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 28/72 (39%)
Ribosomal_S27 103..147 CDD:460261
F52C6.3NP_494127.2 Ubl1_cv_Nsp3_N-like 103..173 CDD:475130 27/70 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.