powered by:
Protein Alignment RpS27A and F34H10.1
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359527.1 |
Gene: | F34H10.1 / 185243 |
WormBaseID: | WBGene00009378 |
Length: | 63 |
Species: | Caenorhabditis elegans |
Alignment Length: | 46 |
Identity: | 10/46 - (21%) |
Similarity: | 21/46 - (45%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 46
:|:||:.:.... ..|..::.:.:..:|......::|||.||
Worm 20 LQMFVRLMPKNQ-----RKSSIVQKLISPFKDGFTCKEEKQRLCFA 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpS27A | NP_476778.1 |
Ubl_ubiquitin |
1..76 |
CDD:340501 |
10/46 (22%) |
Ribosomal_S27 |
103..147 |
CDD:396259 |
|
F34H10.1 | NP_001359527.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160156796 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.700 |
|
Return to query results.
Submit another query.