DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and F34H10.1

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001359527.1 Gene:F34H10.1 / 185243 WormBaseID:WBGene00009378 Length:63 Species:Caenorhabditis elegans


Alignment Length:46 Identity:10/46 - (21%)
Similarity:21/46 - (45%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 46
            :|:||:.:....     ..|..::.:.:..:|......::|||.||
 Worm    20 LQMFVRLMPKNQ-----RKSSIVQKLISPFKDGFTCKEEKQRLCFA 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 10/46 (22%)
Ribosomal_S27 103..147 CDD:460261
F34H10.1NP_001359527.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.