DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and C16C8.5

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_494543.1 Gene:C16C8.5 / 182672 WormBaseID:WBGene00015843 Length:180 Species:Caenorhabditis elegans


Alignment Length:74 Identity:20/74 - (27%)
Similarity:35/74 - (47%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEVEPSDTIENVKAKIQD-KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK 78
            :||..|..|..|:.|:.: ......:...|.:.|::|:|.|::..|||.:...::|         
 Worm   100 VEVRNSYLIRYVRVKVANLLNNDLVESFNLYYGGQKLQDNRSIGSYNIDQSREIYL--------- 155

  Fly    79 KRKKKNYST 87
             :|||..||
 Worm   156 -KKKKKLST 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 15/61 (25%)
Ribosomal_S27 103..147 CDD:396259
C16C8.5NP_494543.1 UBQ 87..154 CDD:214563 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.