DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and rad-23

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_496488.2 Gene:rad-23 / 174785 WormBaseID:WBGene00013924 Length:323 Species:Caenorhabditis elegans


Alignment Length:83 Identity:25/83 - (30%)
Similarity:42/83 - (50%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
            :.:..:|||.....||:....||..|||.:..::|  ..|:.|:||:.||.|:|...:.:...  
 Worm     3 LSVTFRTLTQVNFNLELNEDQTIAEVKALVASEKGDDYAPELQKLIYNGKILDDSVKVGEVGF-- 65

  Fly    64 ESTLHLVLRLRGGAKKRK 81
            :|:..:|:.|    .|||
 Worm    66 DSSKFVVVML----SKRK 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 22/76 (29%)
Ribosomal_S27 103..147 CDD:396259
rad-23NP_496488.2 rad23 3..319 CDD:273167 25/83 (30%)
RAD23_N 3..79 CDD:176400 23/81 (28%)
UBA1_Rad23_like 128..166 CDD:270466
XPC-binding 196..248 CDD:286376
UBA_like_SF 278..318 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.