DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and F52C6.2

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_494128.3 Gene:F52C6.2 / 173558 WormBaseID:WBGene00018659 Length:228 Species:Caenorhabditis elegans


Alignment Length:69 Identity:32/69 - (46%)
Similarity:50/69 - (72%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLT-GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 66
            :|||..| |||..:.::.:|||..:|.|:|:||||||:||||:|.|.:|.|.||::...:::.::
 Worm   156 VFVKNSTGGKTTAVSIKNTDTIGTLKLKVQEKEGIPPNQQRLLFKGSELMDYRTVAHCGLRQGTS 220

  Fly    67 LHLV 70
            |.||
 Worm   221 LDLV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 32/69 (46%)
Ribosomal_S27 103..147 CDD:396259
F52C6.2NP_494128.3 ubiquitin 157..224 CDD:365970 30/66 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.