DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and K10C2.12

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001257042.1 Gene:K10C2.12 / 13221052 WormBaseID:WBGene00206386 Length:88 Species:Caenorhabditis elegans


Alignment Length:92 Identity:24/92 - (26%)
Similarity:41/92 - (44%) Gaps:19/92 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKT--LTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKES 65
            ::.||  ..|.||.|.:..:.|:...|:||::...:|...|.::|....|||.:.|.:|.|:...
 Worm     7 VYNKTRKYAGHTIDLNLGDNATVAEAKSKIEEMTTVPSQIQWIVFGTTHLEDSKPLREYGIRDGY 71

  Fly    66 TLHLVLRLRGGAKKRKKKNYSTPKKIK 92
            |:                 ||||..::
 Worm    72 TI-----------------YSTPTYVE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 20/74 (27%)
Ribosomal_S27 103..147 CDD:460261
K10C2.12NP_001257042.1 Ubl_ubiquitin_like 16..74 CDD:340559 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.