DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpS27A and AgaP_AGAP000733

DIOPT Version :9

Sequence 1:	NP_476778.1	Gene:	RpS27A / 34420	FlyBaseID:	FBgn0003942	Length:	156	Species:	Drosophila melanogaster
Sequence 2:	XP_311268.5	Gene:	AgaP_AGAP000733 / 1272322	VectorBaseID:	AGAP000733	Length:	390	Species:	Anopheles gambiae

Alignment Length:	64	Identity:	26/64 - (40%)
Similarity:	40/64 - (62%)	Gaps:	3/64 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGI--PPDQQRLIFAGKQLEDGRTLSDYNI 61
            |:|.:|||..:|..:||: ..||:..:|.|:..:.|:  |.|:||||:.||.:||...||.|.:
Mosquito     1 MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLSQYKL 64

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpS27A	NP_476778.1	Ubl_ubiquitin	1..76	CDD:340501	26/64 (41%)
RpS27A	NP_476778.1	Ribosomal_S27	103..147	CDD:396259
AgaP_AGAP000733	XP_311268.5	rad23	1..387	CDD:273167	26/64 (41%)
		RAD23_N	1..78	CDD:176400	26/64 (41%)
		UBA1_NUB1_like	180..212	CDD:270477
		XPC-binding	260..315	CDD:286376
		UBA_like_SF	346..384	CDD:304366
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810