DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and LOC1272322

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_311268.6 Gene:LOC1272322 / 1272322 VectorBaseID:AGAMI1_011087 Length:390 Species:Anopheles gambiae


Alignment Length:64 Identity:26/64 - (40%)
Similarity:40/64 - (62%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGI--PPDQQRLIFAGKQLEDGRTLSDYNI 61
            |:|.:|||..:|..:||: ..||:..:|.|:..:.|:  |.|:||||:.||.:||...||.|.:
Mosquito     1 MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLSQYKL 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 26/64 (41%)
Ribosomal_S27 103..147 CDD:460261
LOC1272322XP_311268.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.