DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and Oas1c

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_291019.1 Gene:Oas1c / 114643 MGIID:2149633 Length:362 Species:Mus musculus


Alignment Length:39 Identity:11/39 - (28%)
Similarity:17/39 - (43%) Gaps:11/39 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
            ||.::|..|  .|:.:.|.|         .||...:|:|
Mouse   118 VKFEVQSSE--EPNSRSLSF---------KLSSPELQQE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 11/39 (28%)
Ribosomal_S27 103..147 CDD:396259
Oas1cNP_291019.1 NT_2-5OAS_ClassI-CCAase 27..>157 CDD:143390 11/39 (28%)
OAS1_C 173..355 CDD:313619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.