powered by:
Protein Alignment RpS27A and erich1
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120014.1 |
Gene: | erich1 / 100144976 |
XenbaseID: | XB-GENE-5807533 |
Length: | 304 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 11/42 - (26%) |
Similarity: | 19/42 - (45%) |
Gaps: | 6/42 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 46
|||| |.::.:|..|......:....:|.||:..|::
Frog 253 VKTL------LLLQDTDRSEEALDNFKASSSLPADQRLAIYS 288
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpS27A | NP_476778.1 |
Ubl_ubiquitin |
1..76 |
CDD:340501 |
11/42 (26%) |
Ribosomal_S27 |
103..147 |
CDD:396259 |
|
erich1 | NP_001120014.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
143 |
1.000 |
Domainoid score |
I4605 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
292 |
1.000 |
Inparanoid score |
I2727 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001906 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103041 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10666 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1259 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 8.010 |
|
Return to query results.
Submit another query.