DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and erich1

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001120014.1 Gene:erich1 / 100144976 XenbaseID:XB-GENE-5807533 Length:304 Species:Xenopus tropicalis


Alignment Length:42 Identity:11/42 - (26%)
Similarity:19/42 - (45%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 46
            ||||      |.::.:|..|......:....:|.||:..|::
 Frog   253 VKTL------LLLQDTDRSEEALDNFKASSSLPADQRLAIYS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 11/42 (26%)
Ribosomal_S27 103..147 CDD:396259
erich1NP_001120014.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4605
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I2727
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001906
OrthoInspector 1 1.000 - - oto103041
Panther 1 1.100 - - LDO PTHR10666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
88.010

Return to query results.
Submit another query.