DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ip259 and RPS8B

DIOPT Version :9

Sequence 1:NP_001260347.1 Gene:Ip259 / 34419 FlyBaseID:FBgn0025366 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_011028.1 Gene:RPS8B / 856839 SGDID:S000000904 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:28/152 - (18%)
Similarity:54/152 - (35%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RHRK--LYGRRLDYEERKRKKEARLPKDRARKARKLRGIKAKLFNKERRNEKIQIKKKIQAHE-- 69
            ||::  ...:|..:.::::.:..|.|.:....|:::..::.:..||:.|..:|:......|.|  
Yeast     8 RHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIETGNFSWASEGI 72

  Fly    70 EKKVK--------KQEEKVEDGAL------------------PHYLLDRGIQSSAKVLSNMIKQK 108
            .||.:        ...|.|....|                  .||....|.:.:.|....:.|.|
Yeast    73 SKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKNVKEEETVAKSK 137

  Fly   109 RKEKAGKWDVPIPKVRAQSDAE 130
            ..|:  ||.......:.:|..|
Yeast   138 NAER--KWAARAASAKIESSVE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ip259NP_001260347.1 NSA2 4..259 CDD:211393 28/152 (18%)
RPS8BNP_011028.1 PTZ00148 1..200 CDD:240292 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.