DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ip259 and rps8b

DIOPT Version :9

Sequence 1:NP_001260347.1 Gene:Ip259 / 34419 FlyBaseID:FBgn0025366 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001128155.1 Gene:rps8b / 100000836 ZFINID:ZDB-GENE-050522-202 Length:208 Species:Danio rerio


Alignment Length:142 Identity:24/142 - (16%)
Similarity:56/142 - (39%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EYMERHRKLYGRRLDYEERKRKKEARLPKDRARKARKLRGIKAKLFNKERR-------------- 55
            ::..:.||..|:|..|.::::.:..|.|.:.....|::..::.:..||:.|              
Zfish     6 DHWHKRRKTGGKRKPYHKKRKYELGRPPANTKIGPRRIHTVRVRGGNKKYRALRLDSGNFSWGSE 70

  Fly    56 --NEKIQIKKKIQAHEEKKVKKQEEKVED-----GALP-------HYLLDRGIQSSAKVL---SN 103
              ..|.:|...:......::.:.:..|::     .:.|       ||.:..|.:..||:.   ..
Zfish    71 CCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLVDSAPYRQWYEAHYAIPLGRKKGAKLTPEEEE 135

  Fly   104 MIKQKRKEKAGK 115
            ::.:||.:|..|
Zfish   136 ILNKKRSKKVQK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ip259NP_001260347.1 NSA2 4..259 CDD:211393 24/142 (17%)
rps8bNP_001128155.1 PTZ00148 1..206 CDD:240292 24/142 (17%)
Ribosomal_S8e_like 5..190 CDD:211392 24/142 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.