DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnot4 and AT1G74870

DIOPT Version :9

Sequence 1:NP_001260343.1 Gene:Cnot4 / 34416 FlyBaseID:FBgn0051716 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_177625.1 Gene:AT1G74870 / 843826 AraportID:AT1G74870 Length:289 Species:Arabidopsis thaliana


Alignment Length:52 Identity:27/52 - (51%)
Similarity:37/52 - (71%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEY 59
            |...|||:|.|.::..||.|.|||||::||.||.::|..:|.: ||||||:|
plant   207 DGDEECPICSELMDATDLEFEPCTCGFRICLFCHNKISENEAR-CPACRKDY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cnot4NP_001260343.1 zf-RING_4 13..59 CDD:291250 24/45 (53%)
RRM_CNOT4 103..203 CDD:240884
AT1G74870NP_177625.1 PLN02248 199..>288 CDD:215138 27/52 (52%)
mRING-HC-C4C4_CNOT4 212..255 CDD:319532 22/43 (51%)
modified RING-HC finger (C4C4-type) 212..253 CDD:319532 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3664
eggNOG 1 0.900 - - E1_COG5175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12603
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.