powered by:
Protein Alignment Cnot4 and AT1G74870
DIOPT Version :9
Sequence 1: | NP_001260343.1 |
Gene: | Cnot4 / 34416 |
FlyBaseID: | FBgn0051716 |
Length: | 1062 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177625.1 |
Gene: | AT1G74870 / 843826 |
AraportID: | AT1G74870 |
Length: | 289 |
Species: | Arabidopsis thaliana |
Alignment Length: | 52 |
Identity: | 27/52 - (51%) |
Similarity: | 37/52 - (71%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 DDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEY 59
|...|||:|.|.::..||.|.|||||::||.||.::|..:|.: ||||||:|
plant 207 DGDEECPICSELMDATDLEFEPCTCGFRICLFCHNKISENEAR-CPACRKDY 257
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
64 |
1.000 |
Domainoid score |
I3664 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5175 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12603 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.000 |
|
Return to query results.
Submit another query.