DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and LDHAL6B

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_149972.1 Gene:LDHAL6B / 92483 HGNCID:21481 Length:381 Species:Homo sapiens


Alignment Length:191 Identity:43/191 - (22%)
Similarity:73/191 - (38%) Gaps:16/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRVVVTGAAGQ-IAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELA-DCALPLLVE 67
            :.::.||:.|. .|.|:|......|         |.|:|:..  ..|:|..|:|. ......:..
Human    72 VSIIGTGSVGMACAISILLKGLSDE---------LALVDLDE--DKLKGETMDLQHGSPFTKMPN 125

  Fly    68 VVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNP 132
            :|.:.|..|...........||...| |..|.:|:..||.||:....::.::: ...|:::|.||
Human   126 IVCSKDYFVTANSNLVIITAGARQEK-GETRLNLVQRNVAIFKLMISSIVQYS-PHCKLIIVSNP 188

  Fly   133 ANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQYP 193
            .:....|....:.........:...||..|....|..|||:...:....|: |.|..:..|
Human   189 VDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWIL-GEHGDSSVP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 43/191 (23%)
MDH_euk_cyt 6..328 CDD:130819 43/190 (23%)
LDHAL6BNP_149972.1 LDH_1 68..376 CDD:133429 43/191 (23%)
L-LDH-NAD 74..374 CDD:273796 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.