DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and mMDH2

DIOPT Version :10

Sequence 1:NP_609394.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_188120.1 Gene:mMDH2 / 820731 AraportID:AT3G15020 Length:341 Species:Arabidopsis thaliana


Alignment Length:68 Identity:18/68 - (26%)
Similarity:27/68 - (39%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKTLKELLD---RWPGKRTLGIYRFLPIFFGLGAALEFSMIHWRVGETNFYNTFKKRQAKEIVEE 67
            |.|||::::   ..|.:|.|.               |..| |.|.  ...||...:.:.|:  ||
plant  1708 SSTLKKVVEVRVCTPEERKLS---------------EIEM-HQRT--IRLYNQLDEVKTKK--EE 1752

  Fly    68 KLR 70
            |:|
plant  1753 KMR 1755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_609394.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 18/68 (26%)
mMDH2NP_188120.1 PLN00106 14..334 CDD:215058
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.