DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and Uevld

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_008757683.1 Gene:Uevld / 691172 RGDID:1587416 Length:470 Species:Rattus norvegicus


Alignment Length:342 Identity:69/342 - (20%)
Similarity:120/342 - (35%) Gaps:67/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PIRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEV 68
            |.::.|.|:........|.:.|:|..   |:.::|.|.|     |..:| .|:|....|| .||:
  Rat   182 PNKITVVGSGDLGIACTLAISAKGIA---DKLLLLDLSD-----GTNQG-TMDLDIFNLP-NVEI 236

  Fly    69 VPTTDPAVGFKDVSAA-------FLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKV 126
                     .||:||:       |...::...|..  ...:.:||.:||....||..:::..| :
  Rat   237 ---------SKDLSASAHSKVVIFTANSLGGSESY--LHAVQSNVDMFRALVPALGHYSQHAV-L 289

  Fly   127 LVVGNPANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQ 191
            ||...|....:.|....:.............||..|....|::.|....|. |.:.:.|      
  Rat   290 LVASQPVEIMSYVTWKLSTFPAARVMGIGCNLDSQRLQYIISSVLKAQTSG-KEVWVVG------ 347

  Fly   192 YPDAGQAKVTA-NGTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAARKMSSAMSAAKAACDHMH 255
              :.|:.||.: :|          .:|.:..|....:..|...::..:...| .|...:..|.:.
  Rat   348 --EQGENKVCSWSG----------QDGVMSPSSQAQLSSRAMGLLKVKGQRS-WSVGLSVADLLD 399

  Fly   256 DWWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVEIKNKQWKIVSGLTLSDFAKTKLSVTGKELQ 320
            ...|...  :..|:...:.|.|....:|..|.|.        |:....:|:..||       ..:
  Rat   400 TIINNKK--KVHSVSTLAKGYYGLDNEVFLSLPC--------ILGTSGVSEVLKT-------AAE 447

  Fly   321 EEKDEALSVLDSNVSNL 337
            :...|||....|::..|
  Rat   448 DAVTEALQTSASSIHGL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 65/330 (20%)
MDH_euk_cyt 6..328 CDD:130819 65/329 (20%)
UevldXP_008757683.1 UEV 21..138 CDD:283415
NADB_Rossmann 180..467 CDD:304358 69/342 (20%)
L-LDH-NAD 187..461 CDD:273796 67/332 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.