DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and UEVLD

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001035787.1 Gene:UEVLD / 55293 HGNCID:30866 Length:471 Species:Homo sapiens


Alignment Length:341 Identity:73/341 - (21%)
Similarity:122/341 - (35%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVVVTGAAGQIAYS-LLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVV 69
            ::.|.| .|::..: .|.:.|:|..   |:.::|.|.:     |. :|..|:|....|| .||: 
Human   184 KITVVG-GGELGIACTLAISAKGIA---DRLVLLDLSE-----GT-KGATMDLEIFNLP-NVEI- 236

  Fly    70 PTTDPAVGFKDVSAA-------FLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVL 127
                    .||:||:       |.|.::...:..  .|::.:||.:||....||..:::..| :|
Human   237 --------SKDLSASAHSKVVIFTVNSLGSSQSY--LDVVQSNVDMFRALVPALGHYSQHSV-LL 290

  Fly   128 VVGNPANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQY 192
            |...|......|....:.............||..|....|...|....|. |.:.:.|       
Human   291 VASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSG-KEVWVIG------- 347

  Fly   193 PDAGQAKVTANGTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAAR-KMSSAMSAAKAACDHMHD 256
             :.|:.||......:.||           |....||....|:...| |...:.|...:..|.:..
Human   348 -EQGEDKVLTWSGQEEVV-----------SHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDS 400

  Fly   257 WWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVEIKNKQWKIVSGLTLSDFAKTKLSVTGKELQE 321
            ..|...  :..|:...:.|.||...:|..|.|.        |:....:|:..||.|         
Human   401 IVNNKK--KVHSVSALAKGYYDINSEVFLSLPC--------ILGTNGVSEVIKTTL--------- 446

  Fly   322 EKDEALSVLDSNVSNL 337
            ::|.....|.|:.|::
Human   447 KEDTVTEKLQSSASSI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 70/329 (21%)
MDH_euk_cyt 6..328 CDD:130819 70/330 (21%)
UEVLDNP_001035787.1 UEV 21..138 CDD:283415
PLN02602 161..471 CDD:178212 73/341 (21%)
LDH_1 180..468 CDD:133429 73/341 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.