DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and Uevld

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001035785.1 Gene:Uevld / 54122 MGIID:1860490 Length:471 Species:Mus musculus


Alignment Length:354 Identity:77/354 - (21%)
Similarity:116/354 - (32%) Gaps:127/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVV 69
            |.||.:|..| ||.:|. :.|:|..   |:.::|.|.|     |:.:| .|:|....|| .||: 
Mouse   185 ITVVGSGDLG-IACTLA-ISAKGIA---DKLLLLDLSD-----GMSQG-TMDLDIFNLP-NVEI- 236

  Fly    70 PTTDPAVGFKDVSAA-------FLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVL 127
                    .||:||:       |...::...|..  ...:.:||.:||....||..:::..| :|
Mouse   237 --------SKDLSASAHSKVVIFTANSLGGSESY--LHAVQSNVDMFRALVPALGHYSQHAV-LL 290

  Fly   128 VVGNPANTNALVCSSYAPSIPRENFSAMTR-------LDQNRATSQIAAKLGVPISAVK------ 179
            |...|....:.|....:      .|.| ||       ||..|....|.:.|.|..|..:      
Mouse   291 VASQPVEIMSYVTWKLS------TFPA-TRVVGIGCNLDSQRLQYIITSVLKVQTSGKEVWVVGE 348

  Fly   180 ----NIIIWGNHSSTQYPDA---------------GQAKVTANGTVKSVVDAINDNGYLQGSFVE 225
                .:..|........|.:               ||...:...:|..:||.|.:|         
Mouse   349 QGENKVCSWSGRDGVLSPSSQAQLSSRAMELLKVKGQRSWSVGLSVADLVDTIINN--------- 404

  Fly   226 TVQKRGAAVIAARKMSSAMSAAKAACDHMHDWWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVE 290
                       .||:.|..:.||                          |.|....:|..|.|. 
Mouse   405 -----------KRKVHSVSTLAK--------------------------GYYGLDNEVFLSLPC- 431

  Fly   291 IKNKQWKIVSGLTLSDFAKTKL---SVTG 316
                   |:....:|:..|||.   :|||
Mouse   432 -------ILGTGGVSEVIKTKAGEDTVTG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 77/354 (22%)
MDH_euk_cyt 6..328 CDD:130819 76/353 (22%)
UevldNP_001035785.1 UEV 21..138 CDD:283415
PLN02602 177..471 CDD:178212 77/354 (22%)
NADB_Rossmann 183..468 CDD:304358 77/354 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.