DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and uevld

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001003619.1 Gene:uevld / 445225 ZFINID:ZDB-GENE-040801-138 Length:471 Species:Danio rerio


Alignment Length:303 Identity:61/303 - (20%)
Similarity:108/303 - (35%) Gaps:81/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPIRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVE 67
            :.::|.|.|.......::|.::|:..|   |:   |.|:|||.  ...:|..|:|...:|| .||
Zfish   173 QEVKVSVIGGGDLGIAAVLSIMAKSCV---DK---LVLIDIPE--NSTKGGTMDLEIFSLP-KVE 228

  Fly    68 VVPTTDPAVGFKDVSAA-----FLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVL 127
            |         .||:||:     .::.|....:......::..||.::|.....|.:.:...| ::
Zfish   229 V---------SKDLSASAGSKVLVITANAWSDEQSYLSVVQTNVDMYRGIIPRLAQLSPNAV-LV 283

  Fly   128 VVGNPANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKN------------ 180
            :...|.:....|....:..:|.:.......||..| .|.|     :.||.|.|            
Zfish   284 IASQPVDVMTHVAWRQSHLLPTQVIGVGCNLDSQR-LSHI-----INISLVANNTGKQAWVIGEL 342

  Fly   181 ----IIIWGNHSSTQYPDAGQAKVTANGTVKSVVDAINDNGYLQGSFVETVQKRG---------- 231
                :.:|||....  .|..||....:.:.|.::|..          .|.::.||          
Zfish   343 SENKVAVWGNMGPG--TDQLQALTPVSNSTKPLMDRA----------FEMIKGRGQRSWSVGLSI 395

  Fly   232 -----AAVIAARKMSSAMSAAKAACDHMHDWWNGTAPGQFVSM 269
                 :.|...:|:.|..:.|:.        |.|.....|:|:
Zfish   396 ADITHSIVTNQKKVHSVTTLAEG--------WGGIGSKVFLSL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 61/303 (20%)
MDH_euk_cyt 6..328 CDD:130819 61/300 (20%)
uevldNP_001003619.1 UEV 21..139 CDD:283415
LDH_1 172..468 CDD:133429 61/303 (20%)
L-LDH-NAD 179..460 CDD:273796 60/297 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.