DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and mdh2

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_998296.1 Gene:mdh2 / 406405 ZFINID:ZDB-GENE-040426-2143 Length:337 Species:Danio rerio


Alignment Length:287 Identity:66/287 - (22%)
Similarity:106/287 - (36%) Gaps:98/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVVVTGAAGQIAYSLLYMIARGEVFGKDQPIV--LHLLDIPPMVGV------------LEGVV-- 54
            :|.|.||:|.|...|..::       |:.|:|  |.|.||....||            ::|.:  
Zfish    25 KVAVLGASGGIGQPLSLLL-------KNSPLVSELSLFDIAHTPGVAADLSHIETRAHVKGYIGA 82

  Fly    55 MELADCALPLLVEVVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKF 119
            .:|.|......|.|:|                 ..:|||.||.|.||.:.|..|..|   .:|..
Zfish    83 DQLGDALKGCEVVVIP-----------------AGVPRKPGMTRDDLFNTNATIVAT---LVDGC 127

  Fly   120 AK--KDVKVLVVGNPANTNALVCSS-------YAPSIPRENFSAMTRLDQNRATSQIAAKLGVPI 175
            |:  ....:.::.||.|:...:.|.       |.|:    ....:|.||..||.:.:|...|:..
Zfish   128 ARHCPQAMICIISNPVNSTIPITSEVMKKHGVYNPN----KIFGVTTLDIVRANTFVAELKGLDP 188

  Fly   176 SAVKNIIIWGNHS-------------STQYP------------DAGQAKVTA-----NGTVK--- 207
            :.| |:.:.|.|:             ..::|            :||...|.|     :.|:.   
Zfish   189 ARV-NVPVVGGHAGITIIPLISQCTPKVEFPADQLSALTGRIQEAGTEVVKAKAGAGSATLSMAY 252

  Fly   208 -------SVVDAIN-DNGYLQGSFVET 226
                   |::||:| ..|.::.|||.:
Zfish   253 AGARFTFSLLDAMNGKEGVVECSFVRS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 66/287 (23%)
MDH_euk_cyt 6..328 CDD:130819 66/287 (23%)
mdh2NP_998296.1 PLN00106 6..328 CDD:215058 66/287 (23%)
MDH_glyoxysomal_mitochondrial 25..333 CDD:133422 66/287 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.