Sequence 1: | NP_001285803.1 | Gene: | Mdh1 / 34414 | FlyBaseID: | FBgn0262782 | Length: | 337 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998296.1 | Gene: | mdh2 / 406405 | ZFINID: | ZDB-GENE-040426-2143 | Length: | 337 | Species: | Danio rerio |
Alignment Length: | 287 | Identity: | 66/287 - (22%) |
---|---|---|---|
Similarity: | 106/287 - (36%) | Gaps: | 98/287 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 RVVVTGAAGQIAYSLLYMIARGEVFGKDQPIV--LHLLDIPPMVGV------------LEGVV-- 54
Fly 55 MELADCALPLLVEVVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKF 119
Fly 120 AK--KDVKVLVVGNPANTNALVCSS-------YAPSIPRENFSAMTRLDQNRATSQIAAKLGVPI 175
Fly 176 SAVKNIIIWGNHS-------------STQYP------------DAGQAKVTA-----NGTVK--- 207
Fly 208 -------SVVDAIN-DNGYLQGSFVET 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mdh1 | NP_001285803.1 | MDH_cytoplasmic_cytosolic | 3..327 | CDD:133421 | 66/287 (23%) |
MDH_euk_cyt | 6..328 | CDD:130819 | 66/287 (23%) | ||
mdh2 | NP_998296.1 | PLN00106 | 6..328 | CDD:215058 | 66/287 (23%) |
MDH_glyoxysomal_mitochondrial | 25..333 | CDD:133422 | 66/287 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0039 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |