DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and CG10749

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster


Alignment Length:372 Identity:86/372 - (23%)
Similarity:134/372 - (36%) Gaps:125/372 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIV--LHLLDIPPMVGV---------------LEG 52
            ::|.|.|:.|.|...|..::       |..|.:  |.|.||....||               .||
  Fly    28 LKVAVVGSVGGIGQPLSLLL-------KHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEG 85

  Fly    53 -----VVMELADCALPLLVEVVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQ 112
                 ..|:.||      :.|:|                 ..:|||.||:|:||:..|..:    
  Fly    86 KNGLKKAMDKAD------IVVIP-----------------AGLPRKPGMKREDLVDVNASV---- 123

  Fly   113 GQALD-KFAKKDV----KVLVVGNPANTNALVCS-------SYAPSIPRENFSAMTRLDQNRATS 165
              |.: .||..:|    .:..:.||.|....:.:       :|.|:    ....:|.||..||.:
  Fly   124 --ACEVAFAASEVCPGAMLAFITNPINVIVPIVATILKAKGTYDPN----RLFGVTTLDVVRAQT 182

  Fly   166 QIAAKLGVPISAVKNIIIWGNHSSTQYPDAGQAKVTANGTVKSVVDAINDNGYLQGSFVETVQKR 230
            .:|..|.|....|...:|.|:...|..|...|......||.|.           :.:.::.:|..
  Fly   183 FVADILNVDPQKVNIPVIGGHTGRTILPILSQCDPPFKGTDKE-----------REALIQRIQNA 236

  Fly   231 GAAVIAARK--MSSAMSAAKAACDHMHDWWNGTAPGQFVS---MGVFSDGSYDSPKDVIFSFPVE 290
            |..|:.|:.  .|:.:|.|.||.             ||||   .|:  .||.|  :.::....||
  Fly   237 GTEVVNAKDGLGSATLSMAFAAT-------------QFVSSLIKGI--KGSKD--ECIVECAYVE 284

  Fly   291 IKNKQWKIVSGLTLSDFAKTKLSV--------TG-KELQEEKDEALS 328
                     |.:|.:.|..|.|.:        || .:|.:|:.:||:
  Fly   285 ---------SDVTEAQFFATPLILGPQGVKENTGLPDLDDEERKALN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 84/369 (23%)
MDH_euk_cyt 6..328 CDD:130819 85/369 (23%)
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 86/372 (23%)
MDH_euk_gproteo 29..345 CDD:130833 86/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.