DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and Ldhb

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001303262.1 Gene:Ldhb / 24534 RGDID:2997 Length:341 Species:Rattus norvegicus


Alignment Length:367 Identity:73/367 - (19%)
Similarity:127/367 - (34%) Gaps:100/367 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVVP 70
            ::.|.| .||:.     |.....:.||.....|.|:|:  :...|:|.:|:|...:|.|      
  Rat    23 KITVVG-VGQVG-----MACAISILGKSLADELALVDV--LEDKLKGEMMDLQHGSLFL------ 73

  Fly    71 TTDPAVGFKDVSA------AFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVV 129
            .|...|..||.|.      ..:...:.::||..|.:|:..||.:|:.....:.|:: .|..::||
  Rat    74 QTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYS-PDCTIIVV 137

  Fly   130 GNPANTNALVCSSYAPSIPREN-FSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQY- 192
            .||.:....|....: .:|:.. ..:...||..|....:|.|||:..|:....|: |.|..:.. 
  Rat   138 SNPVDILTYVTWKLS-GLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWIL-GEHGDSSVA 200

  Fly   193 ----------------PDAGQAKVTANGTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAARKMS 241
                            |:.|....:.|.  |.|...:.|:.|      |.::.:|..        
  Rat   201 VWSGVNVAGVSLQELNPEMGTDNDSENW--KEVHKMVVDSAY------EVIKLKGYT-------- 249

  Fly   242 SAMSAAKAACDHMHDWWNGTAPGQFVS-----------MGVFSDGSYDSPKDVIFSFPVEIKNKQ 295
                          :|..|.:....:.           :.....|.|....:|..|.|..:..: 
  Rat   250 --------------NWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNAR- 299

  Fly   296 WKIVSGLTLSDFAKTKLSVTGKELQEEKDEALSVLDSNVSNL 337
                 |||         ||..::|   ||:.::.|..:...|
  Rat   300 -----GLT---------SVINQKL---KDDEVAQLRKSADTL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 71/355 (20%)
MDH_euk_cyt 6..328 CDD:130819 71/356 (20%)
LdhbNP_001303262.1 PLN02602 4..332 CDD:178212 73/367 (20%)
LDH_1 20..330 CDD:133429 73/367 (20%)
PTS1 339..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.