DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdh1 and Ldha

DIOPT Version :9

Sequence 1:NP_001285803.1 Gene:Mdh1 / 34414 FlyBaseID:FBgn0262782 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001129541.2 Gene:Ldha / 16828 MGIID:96759 Length:361 Species:Mus musculus


Alignment Length:355 Identity:76/355 - (21%)
Similarity:118/355 - (33%) Gaps:85/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRVVVTGAAGQ-IAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLV-E 67
            |.||..||.|. .|.|:|.         ||....|.|:|:  |...|:|.:|:|...:|.|.. :
Mouse    52 ITVVGVGAVGMACAISILM---------KDLADELALVDV--MEDKLKGEMMDLQHGSLFLKTPK 105

  Fly    68 VVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNP 132
            :|.:.|..|...........||. ::||..|.:|:..||.||:.....:.|:: ...|:|:|.||
Mouse   106 IVSSKDYCVTANSKLVIITAGAR-QQEGESRLNLVQRNVNIFKFIIPNIVKYS-PHCKLLIVSNP 168

  Fly   133 ANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQYP---- 193
            .:....|....:.........:...||..|....:..:|||...:....:: |.|..:..|    
Mouse   169 VDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVL-GEHGDSSVPVWSG 232

  Fly   194 -------------------DAGQAKVTANGTVKSVVDAINDNGYLQ-------GSFVETVQKRGA 232
                               |..|.|......|.|..:.|...||..       ....|::.|.  
Mouse   233 VNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKN-- 295

  Fly   233 AVIAARKMSSAMSAAKAACDHMHDWWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVEIKNKQWK 297
                .|::....:..|                          |.|...:||..|.|..:......
Mouse   296 ----LRRVHPISTMIK--------------------------GLYGINEDVFLSVPCILGQNGIS 330

  Fly   298 IVSGLTLSDFAKTKLSVTG-------KELQ 320
            .|..:||:...:.:|..:.       ||||
Mouse   331 DVVKVTLTPEEEARLKKSADTLWGIQKELQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdh1NP_001285803.1 MDH_cytoplasmic_cytosolic 3..327 CDD:133421 76/355 (21%)
MDH_euk_cyt 6..328 CDD:130819 75/354 (21%)
LdhaNP_001129541.2 LDH_1 48..358 CDD:133429 72/351 (21%)
L-LDH-NAD 54..353 CDD:273796 71/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.