DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and Hand2

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_073187.1 Gene:Hand2 / 64637 RGDID:621207 Length:217 Species:Rattus norvegicus


Alignment Length:96 Identity:27/96 - (28%)
Similarity:44/96 - (45%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 PAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQ 609
            |.:...|..:||...|.:||.|.:.||.|..|| |.|:.::.:|...:|:..|.:|...|..|..
  Rat    90 PGLGGPRPVKRRGTANRKERRRTQSINSAFAEL-RECIPNVPADTKLSKIKTLRLATSYIAYLMD 153

  Fly   610 QVRERNLNPKAACLK--------RREEEKAE 632
            .:.:.:.|.:|...|        :.|:.|.|
  Rat   154 LLAKDDQNGEAEAFKAEIKKTDVKEEKRKKE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 17/52 (33%)
Hand2NP_073187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 8/25 (32%)
bHLH_TS_HAND2 100..161 CDD:381477 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.