DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and net

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:332 Identity:73/332 - (21%)
Similarity:118/332 - (35%) Gaps:115/332 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GPSSSYASEMVPVSSLHTMASVFQGVRMEERLDDALNVLR---------NHCEPEMLAGVNQSLA 395
            ||.||        :|::....:.:.:|.....|.|: ||.         |.|.|..|...::   
  Fly   102 GPPSS--------ASMNATGPLKKRIRYTSSADSAV-VLTPPAIDSPPPNSCIPSTLRLQHE--- 154

  Fly   396 SIDNIDALTSFVPNSPSHLGSGGNSGSVSNTSNAALVHEVLA-----LGAAAAAGTSGQSVGGAG 455
                      .:|| |:|:        .........:|..||     |...|...|..|.|..||
  Fly   155 ----------IMPN-PAHI--------YVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAG 200

  Fly   456 ----SLASLKLDR--SASTSLPKQTKKRKEHTAISNSVPAGVSTTSSLTSLDISDTKPTSSIESS 514
                :.::|.:.:  ||..:|.::|:|.              ||:||.....:||.      :.:
  Fly   201 PKIEAFSALLIGKQPSAKKTLKERTQKE--------------STSSSFLEASLSDE------DLN 245

  Fly   515 NSGL----QQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALK 575
            .:||    :.|...:..|...|                     |||...|||||.|:..|:.|.:
  Fly   246 KTGLAPISRPHQHQRNYKNMTR---------------------ERRIEANARERTRVHTISAAYE 289

  Fly   576 ELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRE-----RNLNPKAACL------------ 623
            .| |..:....|.:..:||.:|.:|...|:||.:...|     :::...|.||            
  Fly   290 TL-RQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTIQTEGK 353

  Fly   624 -KRREEE 629
             ||:::|
  Fly   354 VKRKKDE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 18/52 (35%)
netNP_001259789.1 HLH 269..320 CDD:278439 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.