DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and ASCL1

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens


Alignment Length:275 Identity:58/275 - (21%)
Similarity:86/275 - (31%) Gaps:95/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 AALVHEVLALGAAAAAGTSGQSV------------------------GGAGSLASLKLDRSASTS 469
            ||......|..|||||..:.||.                        .|.|           ..|
Human    28 AACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSGGG-----------HKS 81

  Fly   470 LPKQTKKRKEHTAISNSVPAGVSTTSSLTSLDISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYC 534
            .|||.|:::                             :||.|......:.:..|.|...|::  
Human    82 APKQVKRQR-----------------------------SSSPELMRCKRRLNFSGFGYSLPQQ-- 115

  Fly   535 SSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNM 599
                     :||..|.|        |.|||.|::.:|.....| |..:.:..::|..:|:..|..
Human   116 ---------QPAAVARR--------NERERNRVKLVNLGFATL-REHVPNGAANKKMSKVETLRS 162

  Fly   600 AVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQ 664
            |||.|..|:|.:.|.:....|.       :.....|.:|..:.  .....:.|:|.|||.|....
Human   163 AVEYIRALQQLLDEHDAVSAAF-------QAGVLSPTISPNYS--NDLNSMAGSPVSSYSSDEGS 218

  Fly   665 LVP--PSSQTISTMT 677
            ..|  |..|.:...|
Human   219 YDPLSPEEQELLDFT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 17/52 (33%)
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 14/95 (15%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.