DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and myf6

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_001003982.1 Gene:myf6 / 404208 ZFINID:ZDB-GENE-040309-2 Length:239 Species:Danio rerio


Alignment Length:240 Identity:53/240 - (22%)
Similarity:86/240 - (35%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 SDTKPTSSIES---SNSGLQQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARER 564
            |:|...||.|.   :..|||.|.:|:......:.|.......|            ||:|...|||
Zfish    50 SETGCESSGEEHVLAPPGLQAHCEGQCLMWACKICKRKSAPTD------------RRKAATLRER 102

  Fly   565 IRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAV-------EVIMTLEQQVRERNLNPKAAC 622
            .|::.||||...|.:..:.:.....|  |:.||..|:       :::.:|::|.:..:.:|....
Zfish   103 RRLKKINEAFDALKKKTVPNPNQRLP--KVEILRSAINYIEKLQDLLHSLDEQEQSNDTDPYTYN 165

  Fly   623 LKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQLVPPSSQTISTMTISLPVNQANN 687
            ||               ::|:.|          |.||.:         :|..:.       |.| 
Zfish   166 LK---------------ENHVTP----------SEYHWK---------KTCQSW-------QEN- 188

  Fly   688 GLPPHLQQQQQQQSQLGHAQLPQXHAPPRNPFWKSSSSLSSIKTE 732
              |.|...|     ..||.:... .:...:...:.||.:.||.||
Zfish   189 --PDHSSSQ-----MAGHREGAVLESSESSSLRRLSSIVDSISTE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 16/59 (27%)
myf6NP_001003982.1 Basic 2..92 CDD:279868 11/41 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..59 4/8 (50%)
HLH 93..144 CDD:278439 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..239 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.