DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and sc

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:334 Identity:74/334 - (22%)
Similarity:117/334 - (35%) Gaps:112/334 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 STTSSLTSLDISDTKPTSSIESSNSGLQQH--------------SQGKGTK--RPRRY------- 533
            |||.|.:.|..::|.||:...::.....||              :|..||.  :.|:|       
  Fly    10 STTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKYTPRGMAL 74

  Fly   534 --CSS--ADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSD------ 588
              ||.  :.....:.||...:.:.:..|..|||||.|::.:|.:...|.:.....:.:|      
  Fly    75 TRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGG 139

  Fly   589 ----KPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQ 649
                |..:|:..|.:|||.|..|:..|.:.|                 .|..:.| ::.:.|.|.
  Fly   140 RGPHKKISKVDTLRIAVEYIRRLQDLVDDLN-----------------GGSNIGA-NNAVTQLQL 186

  Fly   650 VGGTPGSSYHSQPAQLVPPSSQTISTM--------TISLPVNQANNGLPPHLQQQQQQQSQLGHA 706
            .  ...||.||.       ||.|.|:.        |||         :.|..||||.|:.|..|.
  Fly   187 C--LDESSSHSS-------SSSTCSSSGHNTYYQNTIS---------VSPLQQQQQLQRQQFNHQ 233

  Fly   707 QLPQX----------------------------HAPPRNPFWKSSSSLSSIKTECIEGSAAKYSD 743
            .|..                             |:|..:  :.||.|..|...|.:....:.:.|
  Fly   234 PLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSS--FNSSMSFDSGTYEGVPQQISTHLD 296

  Fly   744 NLE-LENQV 751
            .|: |:|::
  Fly   297 RLDHLDNEL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 18/62 (29%)
scNP_476803.1 HLH 105..163 CDD:278439 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.