Sequence 1: | NP_001356956.1 | Gene: | da / 34413 | FlyBaseID: | FBgn0267821 | Length: | 775 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571294.1 | Gene: | ascl1a / 30466 | ZFINID: | ZDB-GENE-980526-90 | Length: | 196 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 46/198 - (23%) |
---|---|---|---|
Similarity: | 71/198 - (35%) | Gaps: | 50/198 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 499 SLDISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQ------ 557
Fly 558 -----------ANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQV 611
Fly 612 RERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQLVP--PSSQTIS 674
Fly 675 TMT 677 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
da | NP_001356956.1 | HLH | 560..613 | CDD:197674 | 17/52 (33%) |
ascl1a | NP_571294.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 33..54 | 8/29 (28%) | |
HLH | 94..136 | CDD:197674 | 12/42 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..186 | 8/26 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |