DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and ascl1a

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:198 Identity:46/198 - (23%)
Similarity:71/198 - (35%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 SLDISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQ------ 557
            |:.:|   ||.|         |.|....:|:.:|..||:.|         .:|.|.|..      
Zfish    27 SIQLS---PTDS---------QCSNKSASKQAKRQRSSSPE---------LLRCKRRLNFAGFGY 70

  Fly   558 -----------ANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQV 611
                       ..|.|||.|::.:|.....| |..:.:..::|..:|:..|..|||.|..|:|.:
Zfish    71 SLPQQQPHAVARRNERERNRVKLVNNGFATL-REHVPNGAANKKMSKVETLRSAVEYIRALQQLL 134

  Fly   612 RERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQLVP--PSSQTIS 674
            .|.:....|.       :.....|.:|..:.  .....:.|:|.|||.|......|  |..|.:.
Zfish   135 DEHDAVSAAF-------QSGVLSPTISQNYS--NDMNSMAGSPVSSYSSDEGSYDPLSPEEQELL 190

  Fly   675 TMT 677
            ..|
Zfish   191 DFT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 17/52 (33%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54 8/29 (28%)
HLH 94..136 CDD:197674 12/42 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.