DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and myog

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_571081.1 Gene:myog / 30200 ZFINID:ZDB-GENE-980526-265 Length:256 Species:Danio rerio


Alignment Length:180 Identity:44/180 - (24%)
Similarity:72/180 - (40%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 TSLDISDTKPTSSIESSNSGL-------QQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKER 555
            |::.:.| ||:   .||:.||       |||..|:......:.|..           |:: ..:|
Zfish    55 TTVGLED-KPS---PSSSLGLSMSPHQEQQHCPGQCLPWACKVCKR-----------KSV-TMDR 103

  Fly   556 RQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVE-------VIMTLEQQVRE 613
            |:|...||:.|::.:|||.:.|.|..:.:.....|  |:.||..|::       ::.:|.||..|
Zfish   104 RKAATLREKRRLKKVNEAFEALKRSTLMNPNQRLP--KVEILRSAIQYIERLQALVSSLNQQEHE 166

  Fly   614 R-NLNPKA-------------------ACLKRREEEKAEDG--PKLSAQH 641
            : ||:.:|                   .|....|...|.|.  |..|:.|
Zfish   167 QGNLHYRATAAAPHTGVSSSSDQGSGSTCCSSPEWSSASDHCVPAYSSAH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 16/59 (27%)
myogNP_571081.1 BASIC 1..107 CDD:128794 16/67 (24%)
HLH 103..154 CDD:278439 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.