DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and ngn-1

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_500236.1 Gene:ngn-1 / 177045 WormBaseID:WBGene00003595 Length:184 Species:Caenorhabditis elegans


Alignment Length:169 Identity:47/169 - (27%)
Similarity:68/169 - (40%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 IESSNSGLQQHSQGKGTKRP-----RRY-CSSADEDDDAEPAVKAIREKERRQANNARERIRIRD 569
            :|..|. :.|:|: ..|::|     ||| |..      ..||.....:..||...|||||.|:..
 Worm    21 MEREND-MDQNSK-NSTQKPVKREKRRYRCRK------RSPATIERAKTVRRDKANARERRRMNS 77

  Fly   570 INEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDG 634
            :|:||:.| |..:..|..:...||:..|..|.|.|.:|..|:...:.:....|      |....|
 Worm    78 LNDALEHL-RGILPALPDEPKMTKIETLRKAQEYIASLSFQLSGGSPDSSQCC------ETGSCG 135

  Fly   635 --------PKLSAQHHMIPQPQQVGGTPGSSYHSQPAQL 665
                    .....|....|||.|.    .|||.:.|:|:
 Worm   136 LCSASQSLQSTPFQSPCFPQPLQY----PSSYSNPPSQM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 20/52 (38%)
ngn-1NP_500236.1 bHLH_SF 63..119 CDD:381792 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.