DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and hlh-11

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_499129.2 Gene:hlh-11 / 176360 WormBaseID:WBGene00001955 Length:431 Species:Caenorhabditis elegans


Alignment Length:339 Identity:73/339 - (21%)
Similarity:115/339 - (33%) Gaps:115/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 AISNSVPAGVSTTSSLTSLDIS---------DTKPTSSIES----SNSGLQQHSQGKGTKRPRRY 533
            :::|:..|..|..|:.::.|::         ...|||:|..    :|..|.|.:....|      
 Worm    44 SVTNARMAPPSIMSAASAFDLTASGMQNSLRSVLPTSTIGHAPMLANRSLSQPAPLSPT------ 102

  Fly   534 CSSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILN 598
              |.|.|.         |.:.|||..|..||.|::.||...  |....:...|..:..:|..||.
 Worm   103 --SLDPDR---------RSRMRRQIANCNERRRMQSINAGF--LALRALLPRKEGEKLSKAAILQ 154

  Fly   599 MAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP----KLSAQHHMIPQPQQVG-------- 651
            ...:::..|               |..:.|:..:.|.    ||...||......|:.        
 Worm   155 QTADMVHQL---------------LGHKGEDIPDGGEPKKLKLEEDHHDADHQAQIAHLQTILET 204

  Fly   652 -GTPGSSYHSQPAQL------VPPSSQTISTMT--------ISLPVNQANNGLPPHLQQQQQQQS 701
             .....:..||..||      ...|||..|.:|        .:||.:.|::.||..|::      
 Worm   205 ERAARKALESQVIQLRELLQMTTTSSQASSPVTPRSNGSGGFTLPSSYASSALPTPLRE------ 263

  Fly   702 QLGHAQLPQXHAPPRNP-FWKSSSSLSSIKTECIEGSAAKYSDNL-------------ELENQVL 752
                       :|.|.| |..::|:..|:.|  :.||... |::|             .||..|:
 Worm   264 -----------SPERKPSFQDTTSTPLSLLT--LNGSPTS-SESLASQRIFHPPPTLPSLETTVI 314

  Fly   753 SNMFWRCRPPKLQP 766
                   ||..|.|
 Worm   315 -------RPTPLPP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 12/52 (23%)
hlh-11NP_499129.2 HLH 113..163 CDD:278439 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.