DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment da and Ascl1

DIOPT Version :9

Sequence 1:NP_001356956.1 Gene:da / 34413 FlyBaseID:FBgn0267821 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:91/243 - (37%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 ALGAAAAAGTSGQSVGGAGSLASLKLDRSASTSLPKQTKKRKEHTAISNSVPAGVSTTSSLTSLD 501
            |..|||||..:.||.            :......|.|  :..:.:.:::|.|:|....|:...: 
Mouse    32 AAAAAAAAAAAAQSA------------QQQQPQAPPQ--QAPQLSPVADSQPSGGGHKSAAKQV- 81

  Fly   502 ISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARERIR 566
              ..:.:||.|......:.:..|.|...|::           :||..|.|        |.|||.|
Mouse    82 --KRQRSSSPELMRCKRRLNFSGFGYSLPQQ-----------QPAAVARR--------NERERNR 125

  Fly   567 IRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKA 631
            ::.:|.....| |..:.:..::|..:|:..|..|||.|..|:|.:.|.:....|.       :..
Mouse   126 VKLVNLGFATL-REHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAF-------QAG 182

  Fly   632 EDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQLVP--PSSQTISTMT 677
            ...|.:|..:.  .....:.|:|.|||.|......|  |..|.:...|
Mouse   183 VLSPTISPNYS--NDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daNP_001356956.1 HLH 560..613 CDD:197674 17/52 (33%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 12/69 (17%)
HLH 129..171 CDD:197674 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.