DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and rpsG

DIOPT Version :10

Sequence 1:NP_523537.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_417800.1 Gene:rpsG / 947846 ECOCYCID:EG10906 Length:179 Species:Escherichia coli


Alignment Length:157 Identity:53/157 - (33%)
Similarity:90/157 - (57%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQA 125
            |..|..:...|.:|.:...|..:.|.:::...||.:.:         :..|:.:..     .:.|
E. coli    15 DPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ---------RSGKSELEA-----FEVA 65

  Fly   126 VENCRPLLQVTAIKRGGVTYQVPVPITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAAH 190
            :||.||.::|.:.:.||.||||||.:...|...|||:|::||||::..| |:..:||.|:.|||.
E. coli    66 LENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDK-SMALRLANELSDAAE 129

  Fly   191 GQGRVIKRKDDLHRLCESNRAYAHYRW 217
            .:|..:|:::|:||:.|:|:|:|||||
E. coli   130 NKGTAVKKREDVHRMAEANKAFAHYRW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_523537.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 50/154 (32%)
rpsGNP_417800.1 PRK05302 1..156 CDD:235398 51/155 (33%)

Return to query results.
Submit another query.