DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and rps7

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_051104.1 Gene:rps7 / 844712 -ID:- Length:155 Species:Arabidopsis thaliana


Alignment Length:157 Identity:55/157 - (35%)
Similarity:96/157 - (61%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SDTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQ 124
            ||.|:.:...:.::|.|.|.|..:||..::.:.|:.|:            :||  .|||.::|:|
plant    14 SDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQ------------QKT--ETNPLSVLRQ 64

  Fly   125 AVENCRPLLQVTAIKRGGVTYQVPVPITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAA 189
            |:....|.:.|.|.:.||.|:|||:.|.:.:...||::|||.|:|::..: ::..||:.|::|||
plant    65 AIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGR-NMAFKLSSELVDAA 128

  Fly   190 HGQGRVIKRKDDLHRLCESNRAYAHYR 216
            .|.|..|::|::.||:.|:|||:||:|
plant   129 KGSGDAIRKKEETHRMAEANRAFAHFR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 54/155 (35%)
rps7NP_051104.1 rps7 1..155 CDD:176994 54/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2753
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9321
Inparanoid 1 1.050 97 1.000 Inparanoid score I2202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1212658at2759
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto3789
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4022
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.