DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and RPS5B

DIOPT Version :10

Sequence 1:NP_523537.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_181264.1 Gene:RPS5B / 818304 AraportID:AT2G37270 Length:207 Species:Arabidopsis thaliana


Alignment Length:135 Identity:37/135 - (27%)
Similarity:62/135 - (45%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GNSALARTLLSKTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVT 144
            |...:|..::...:|:|      |:        ..:.||..::..|:.|..|....|.|...||.
plant    87 GKKLMAVRIVKHAMEII------HL--------LSDLNPIQVIIDAIVNSGPREDATRIGSAGVV 137

  Fly   145 YQVPVPITTKRSYFLAMKWLLEAAREKE-RKV-SLPEKLAWEILDAAHGQGR--VIKRKDDLHRL 205
            .:..|.|:..|....|:..|...|||.. |.: ::.|.||.|:::||.|...  .||:||::.|:
plant   138 RRQAVDISPLRRVNQAIFLLTTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDEIERV 202

  Fly   206 CESNR 210
            .::||
plant   203 AKANR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_523537.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 37/135 (27%)
RPS5BNP_181264.1 uS7_Eukaryote 20..207 CDD:271246 35/133 (26%)

Return to query results.
Submit another query.