DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and mrps7

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001028768.1 Gene:mrps7 / 619204 ZFINID:ZDB-GENE-050809-112 Length:228 Species:Danio rerio


Alignment Length:213 Identity:90/213 - (42%)
Similarity:130/213 - (61%) Gaps:13/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CLRLMSVYPTHYVEPIVQKYKQL-------EQKNDLSKLYHV-PIKAAVNKSSDTIFHDDTKHKM 72
            ||...|.|..:|::|..:|...:       ||| :|.:|..| |||||:...:.:.|.|....|.
Zfish    17 CLMRWSRYNPYYLDPEPRKDAPVSDSELSPEQK-ELQELKTVRPIKAALTGDTSSAFSDPLISKF 80

  Fly    73 INYITKKGNSALARTLLSKTLELIKRTQTE--HMNLAKGEKTTINTNPETLLKQAVENCRPLLQV 135
            ||.:...||..|||.::::|||.|||.|.|  |.:.| .::..|..||..:..||:|||:|::.:
Zfish    81 INMMMYDGNKVLARGIMTQTLETIKRKQVEKYHKSPA-AKREEIECNPYAIFHQAMENCKPVIGL 144

  Fly   136 TAIKRGGVTYQVPVPITTKRSYFLAMKWLL-EAAREKERKVSLPEKLAWEILDAAHGQGRVIKRK 199
            .:|::||..||||||:|..|..|:||||:: |....|:.:..:.|||:.|:|.|...:|.|||||
Zfish   145 ASIQKGGKFYQVPVPLTDNRRRFMAMKWMITECRTNKQGRTLMYEKLSQELLAAFANEGNVIKRK 209

  Fly   200 DDLHRLCESNRAYAHYRW 217
            .|||::.|:|||||||||
Zfish   210 HDLHKMAEANRAYAHYRW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 85/205 (41%)
mrps7NP_001028768.1 uS7_Mitochondria_Mammalian 22..226 CDD:271249 85/205 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581575
Domainoid 1 1.000 122 1.000 Domainoid score I5606
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9321
Inparanoid 1 1.050 155 1.000 Inparanoid score I4272
OMA 1 1.010 - - QHG45686
OrthoDB 1 1.010 - - D1212658at2759
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto40701
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1258
SonicParanoid 1 1.000 - - X4022
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.