DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and rps5

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001016992.1 Gene:rps5 / 549746 XenbaseID:XB-GENE-919703 Length:203 Species:Xenopus tropicalis


Alignment Length:190 Identity:50/190 - (26%)
Similarity:85/190 - (44%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QKNDLSKLYHVPIKAAVNKSSDTIFHDDTKH--------------KMINYITKKGNSALARTLLS 90
            |.||:|...::.:|   .|.:..:.|...::              :..|.:...|.:...:.:  
 Frog    28 QINDISLQDYIAVK---EKYAKFLPHSGGRYAAKRFRKAQCPIVERFTNSLMMHGRNNGKKLM-- 87

  Fly    91 KTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVPITTKR 155
             |:.::|.. .|.::|..||      ||..:|..|:.|..|....|.|.|.|...:..|.::..|
 Frog    88 -TVRIVKHA-FEIIHLLTGE------NPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVDVSPLR 144

  Fly   156 SYFLAMKWLL-EAAREKE-RKV-SLPEKLAWEILDAAHGQGR--VIKRKDDLHRLCESNR 210
            ....|: ||| ..|||.. |.: ::.|.:|.|:::||.|...  .||:||:|.|:.:|||
 Frog   145 RVNQAI-WLLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIKKKDELERVAKSNR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 50/190 (26%)
rps5NP_001016992.1 uS7_Eukaryote 17..203 CDD:271246 48/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.