DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and MRPS7

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_057055.2 Gene:MRPS7 / 51081 HGNCID:14499 Length:242 Species:Homo sapiens


Alignment Length:207 Identity:84/207 - (40%)
Similarity:127/207 - (61%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVYPTHYVEPIVQK--YKQ-----LEQKNDLSKLYHVP-IKAAVNKSSDTIFHDDTKHKMINYIT 77
            |.|...:.:|::.|  |::     .|::..:.:|.... ||||....:.::|.|....|..|.:.
Human    35 SRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMM 99

  Fly    78 KKGNSALARTLLSKTLELIKRTQTEHMNLAKG-EKTTINTNPETLLKQAVENCRPLLQVTAIKRG 141
            ..||..|||:|:.:|||.:||.|.|..:.|.. |:.||..||.|:..||::||.|::.:..|.:|
Human   100 IGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKG 164

  Fly   142 GVTYQVPVPITTKRSYFLAMKWLLEAAREKE-RKVSLPEKLAWEILDAAHGQGRVIKRKDDLHRL 205
            |..||||||:..:|..||||||::...|:|: ::..:||||:.::|:|.|.||.|||||.|||::
Human   165 GRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKM 229

  Fly   206 CESNRAYAHYRW 217
            .|:|||.|||||
Human   230 AEANRALAHYRW 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 81/204 (40%)
MRPS7NP_057055.2 uS7_Mitochondria_Mammalian 35..240 CDD:271249 81/204 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147739
Domainoid 1 1.000 134 1.000 Domainoid score I5027
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9321
Inparanoid 1 1.050 154 1.000 Inparanoid score I4335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45686
OrthoDB 1 1.010 - - D1212658at2759
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto88669
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4022
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.