DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and Mrps7

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_079581.1 Gene:Mrps7 / 50529 MGIID:1354367 Length:242 Species:Mus musculus


Alignment Length:209 Identity:87/209 - (41%)
Similarity:126/209 - (60%) Gaps:14/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVYPTHYVEPIVQK--YKQ------LEQKND--LSKLYHVPIKAAVNKSSDTIFHDDTKHKMINY 75
            |.|...:.||::.|  |::      .|:|.|  |.|...  ||||....:.::|.|....|..|.
Mouse    35 SRYAPEFREPLIDKEYYRKPVAELTEEEKYDQELKKTQF--IKAAAATETSSVFADPVISKFTNM 97

  Fly    76 ITKKGNSALARTLLSKTLELIKRTQTEHMNLAKG-EKTTINTNPETLLKQAVENCRPLLQVTAIK 139
            :.|.||..|||:|:::|||.:||.|.|....|.. |:.||..||..:..:|::||.|::.:..|.
Mouse    98 MMKGGNKVLARSLMAQTLEAVKRKQFEKYRAASAEEQATIERNPYRIFHEALKNCEPVIGLVPIL 162

  Fly   140 RGGVTYQVPVPITTKRSYFLAMKWLLEAARE-KERKVSLPEKLAWEILDAAHGQGRVIKRKDDLH 203
            :||..||||||:..:|..||||||::...|| |.|:..:||||:.|:|:|.|.:|.|||||.::|
Mouse   163 KGGHFYQVPVPLADRRRRFLAMKWMITECRENKPRRTLMPEKLSHELLEAFHNRGPVIKRKHNMH 227

  Fly   204 RLCESNRAYAHYRW 217
            ::.|:|||.|||||
Mouse   228 KMAEANRALAHYRW 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 84/206 (41%)
Mrps7NP_079581.1 uS7_Mitochondria_Mammalian 35..240 CDD:271249 84/206 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837820
Domainoid 1 1.000 133 1.000 Domainoid score I5057
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9321
Inparanoid 1 1.050 156 1.000 Inparanoid score I4281
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45686
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto92237
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1258
SonicParanoid 1 1.000 - - X4022
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.