DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and SPAC16E8.10c

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_594222.2 Gene:SPAC16E8.10c / 2542330 PomBaseID:SPAC16E8.10c Length:259 Species:Schizosaccharomyces pombe


Alignment Length:186 Identity:46/186 - (24%)
Similarity:85/186 - (45%) Gaps:20/186 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KQLEQKNDL-----SKLYHVPIKAAVNKSSDTIFHDDTKHKMINYITKKGNSALARTLLSKTLEL 95
            |::|.:|:.     :.|:..|..:.|.........|.|...::|.|.:.|..|.|..:::..|.:
pombe    88 KKIEVENEEPPLMGTNLWPSPSSSIVGLIDRPFQVDSTVQHLVNLIMRDGKKAKAEKIVATALSI 152

  Fly    96 IKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVPITTKRSYFLA 160
            |::...|              ||..:||||:....||:::.:.||...:.:.|:|:..::...:|
pombe   153 IQKETGE--------------NPIDVLKQAIAEISPLMKLVSAKRFNKSVEFPMPLKERQRRRIA 203

  Fly   161 MKWLLEAAREKERKVSLPEKLAWEILDAAHGQGRVIKRKDDLHRLCESNRAYAHYR 216
            ::|:|...:....| .|.:::..||:..........|:||.|||:|..||..|..|
pombe   204 LQWILGECKSSSPK-RLSDRIVKEIIAIRSKTSNCFKKKDHLHRMCLVNRGNAPVR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 45/184 (24%)
SPAC16E8.10cNP_594222.2 uS7_Mitochondria_Fungi 116..252 CDD:271247 36/150 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I2799
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1942
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto100604
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1258
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.