DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and rps-5

DIOPT Version :10

Sequence 1:NP_523537.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_502077.1 Gene:rps-5 / 178012 WormBaseID:WBGene00004474 Length:210 Species:Caenorhabditis elegans


Alignment Length:70 Identity:19/70 - (27%)
Similarity:30/70 - (42%) Gaps:16/70 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DVRRCQI------TGLH------GCTFVDKTRDGAI-YQEGRDAVTI---NEWTDRVYQHTPQEH 163
            |::|.||      ..:|      ..|.|:...:.|: :.||...|.|   |....:::.|||.||
 Worm    62 DIQRRQIFYNHKLNSIHREYYFTNATLVNHVCNVAMFFGEGAGDVIIENKNYTLLQMHWHTPSEH 126

  Fly   164 IITNV 168
            .:..|
 Worm   127 HLHGV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_523537.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 19/70 (27%)
rps-5NP_502077.1 uS7_Eukaryote 25..210 CDD:271246 19/70 (27%)

Return to query results.
Submit another query.