DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and rps-5

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_502077.1 Gene:rps-5 / 178012 WormBaseID:WBGene00004474 Length:210 Species:Caenorhabditis elegans


Alignment Length:187 Identity:54/187 - (28%)
Similarity:88/187 - (47%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NDLSKLYHVPIKAAVNKSSDTIFHDDTKHKMINY-------ITKKGNSAL------ARTLLSKTL 93
            :|:|.:.::|:|   .||:..:.|...:.::..:       :.:..||.:      .:.|:  |:
 Worm    37 SDISLVDYIPVK---EKSAKYLPHSAGRFQVRRFRKAACPIVERLANSLMMHGRNNGKKLM--TV 96

  Fly    94 ELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVPITTKRSYF 158
            .::|.. .|.:.|..||      ||..:|..||.|..|....|.|.|.|...:..|.:...|...
 Worm    97 RIVKHA-FEIIYLLTGE------NPVQVLVNAVINSGPREDSTRIGRAGTVRRQAVDVAPLRRVN 154

  Fly   159 LAMKWLL-EAAREKE-RKV-SLPEKLAWEILDAAHGQGR--VIKRKDDLHRLCESNR 210
            .|: ||| ..|||.. |.| ::.|.||.|:::||.|...  .||:||:|.|:.:|||
 Worm   155 QAI-WLLCTGAREAAFRNVKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 54/187 (29%)
rps-5NP_502077.1 uS7_Eukaryote 25..210 CDD:271246 52/185 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.